Measuring and Observing and Testing Equipment

Immunogen Recombinant protein corresponding to C-X3-C motif chemokine receptor 1 Sequence HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Synthetic peptide directed towards the middle region of human CXCL3 Application Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions CXCL3 is a chemokine that

Immunogen chemokine (C-X-C motif) receptor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen chromosome X open reading frame 40B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen diacylglycerol lipase, alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to DAN domain BMP antagonist family member 5 Sequence GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA Application All Prestige Antibodies Powered by Atlas

Immunogen DAN domain family, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen D-amino acid oxidase activator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Death domain associated protein (Daxx), also known as ETS associated protein 1 (EAP1), is an adaptor protein that binds to the death domain of Fas. Daxx is a 120 kDa protein with a nuclear localization signal sequence.

DAXX (death-domain associated protein) is a nuclear protein, which is highly conserved in nature. It shuttles between nucleus and cytoplasm.

Immunogen Recombinant protein corresponding to death-domain associated protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen death-domain associated protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in