-
Add to Cart The item has been addedHPA073628-100ULSigma-Aldrich
Anti-DEDD antibody produced in rabbit (C15-1466-410)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to death effector domain containing Sequence LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA041745-100ULImmunogen differentially expressed in FDCP 8 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA076422-100ULImmunogen delta(4)-desaturase, sphingolipid 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA054505-100ULSigma-Aldrich
Anti-DEK antibody produced in rabbit (C15-1461-701)
Price: $928.29List Price: $1,031.43Immunogen DEK proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA057799-100ULSigma-Aldrich
Anti-DEK antibody produced in rabbit (C15-1462-758)
Price: $928.29List Price: $1,031.43Immunogen DEK proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA037818-100ULImmunogen DEPP1, autophagy regulator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA023938-100ULSigma-Aldrich
Anti-DEPTOR antibody produced in rabbit (C15-1450-570)
Price: $879.43List Price: $977.14DEPTOR (DEP domain containing MTOR-interacting protein) is a tumor suppressor and mTOR-binding protein. This protein is expressed in vascular endothelial cells. -
Add to Cart The item has been addedHPA023945-100ULSigma-Aldrich
Anti-DEPTOR antibody produced in rabbit (C15-1450-574)
Price: $879.43List Price: $977.14DEPTOR (DEP domain containing MTOR-interacting protein) is a tumor suppressor and mTOR-binding protein. This protein is expressed in vascular endothelial cells. -
Add to Cart The item has been addedHPA024011-100ULSigma-Aldrich
ANTI-DEPTOR antibody produced in rabbit (C15-1450-598)
Price: $879.43List Price: $977.14DEPTOR (DEP domain containing MTOR-interacting protein) is a tumor suppressor and mTOR-binding protein. This protein is expressed in vascular endothelial cells. -
Add to Cart The item has been addedHPA055897-100ULImmunogen deoxyribose-phosphate aldolase (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA016562-100ULImmunogen Derlin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA018803-100ULThe gene desmin (DES) is mapped to human chromosome 2q35. It is a member of the intermediate filament protein gene family.
