Measuring and Observing and Testing Equipment

Immunogen dipeptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen DPH3, KTI11 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen DPH5 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to diphthamide biosynthesis 5. Sequence VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen dipeptidyl-peptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Bardet-Biedl syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen dipeptidyl peptidase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen dipeptidyl peptidase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

DPP8 (dipeptidyl-peptidase 8) is a dipeptidyl aminopeptidase, which cleaves in a post-proline manner, and is a homolog of DPPIV and FAP (fibroblast activation protein). This gene is localized to human chromosome 15q22, and codes for a protein of

The DPPA5 (developmental pluripotency associated 5) protein is strongly expressed in primordial germ cells, and the expression is down-regulated during germ cell development. Immunogen synthetic peptide corresponding to residues 43-60 human DPPA5.

Immunogen developmental pluripotency associated 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive