Measuring and Observing and Testing Equipment

Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen E2F-associated phosphoprotein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene EBAG9 (estrogen receptor-binding fragment-associated gene 9) is mapped to human chromosome 8q23. It is a type II transmembrane protein and is ubiquitously expressed.

The gene EBAG9 (estrogen receptor-binding fragment-associated gene 9) is mapped to human chromosome 8q23. It is a type II transmembrane protein and is ubiquitously expressed.

Immunogen endogenous Bornavirus-like nucleoprotein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen endogenous Bornavirus-like nucleoprotein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene EBP (emopamil binding protein), also referred to as CDPX2, is mapped to human chromosome Xp11.23-p11.

Immunogen Recombinant protein corresponding to endothelial cell surface expressed chemotaxis and apoptosis regulator Sequence SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen ectodysplasin A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.