-
HPA051209-100ULImmunogen EF-hand calcium binding domain 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA031206-100UL
Sigma-Aldrich
Anti-EFCAB2 antibody produced in rabbit (C15-1453-030)
Price: $889.20List Price: $988.00Immunogen EF-hand calcium binding domain 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA031207-100UL
Sigma-Aldrich
Anti-EFCAB2 antibody produced in rabbit (C15-1453-031)
Price: $889.20List Price: $988.00Immunogen EF-hand calcium binding domain 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA046862-100ULImmunogen EF-hand calcium binding domain 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
HPA029611-100UL
Sigma-Aldrich
Anti-EFCAB7 antibody produced in rabbit (C15-1452-338)
Price: $879.43List Price: $977.14Immunogen EF-hand calcium binding domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029612-100UL
Sigma-Aldrich
Anti-EFCAB7 antibody produced in rabbit (C15-1452-339)
Price: $879.43List Price: $977.14Immunogen EF-hand calcium binding domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029613-100UL
Sigma-Aldrich
Anti-EFCAB7 antibody produced in rabbit (C15-1452-340)
Price: $879.43List Price: $977.14Immunogen EF-hand calcium binding domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA042751-100ULImmunogen EF-hand calcium binding domain 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA035307-100ULImmunogen EF-hand domain (C-terminal) containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA069549-100ULImmunogen ephrin A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
-
HPA067567-100ULImmunogen Recombinant protein corresponding to ephrin A2 Sequence PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
-
HPA022859-100UL
Sigma-Aldrich
Anti-EFR3A antibody produced in rabbit (C15-1450-154)
Price: $879.43List Price: $977.14EFR3A (EFR3 homolog A) is a plasma membrane localized protein mapped to human chromosome 8q24 region. Immunogen Protein EFR3 homolog A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies