-
HPA067307-100UL
Sigma-Aldrich
Anti-FAM126B antibody produced in rabbit (C15-1465-272)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 126, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA042173-100ULImmunogen family with sequence similarity 127, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA028172-100UL
Sigma-Aldrich
Anti-FAM129A antibody produced in rabbit (C15-1451-733)
Price: $879.43List Price: $977.14Immunogen family with sequence similarity 129, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028231-100UL
Sigma-Aldrich
Anti-FAM129A antibody produced in rabbit (C15-1451-759)
Price: $879.43List Price: $977.14Immunogen family with sequence similarity 129, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028657-100UL
Sigma-Aldrich
Anti-FAM129A antibody produced in rabbit (C15-1451-941)
Price: $879.43List Price: $977.14Immunogen family with sequence similarity 129, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA021284-100UL
Sigma-Aldrich
Anti-FAM129B antibody produced in rabbit (C15-1449-816)
Price: $879.43List Price: $977.14FAM129B (MINERVA) localizes in the cytoplasm and moves to the adherens junctions in presence of β-catenin. The protein contains a pleckstrin homology domain and a proline rich region. -
HPA021417-100UL
Sigma-Aldrich
Anti-FAM129B antibody produced in rabbit (C15-1449-858)
Price: $879.43List Price: $977.14FAM129B (MINERVA) localizes in the cytoplasm and moves to the adherens junctions in the presence of β-catenin. The protein contains a pleckstrin homology domain and a proline rich region. -
HPA023261-100UL
Sigma-Aldrich
Anti-FAM129B antibody produced in rabbit (C15-1450-319)
Price: $879.43List Price: $977.14FAM129B (family with sequence similarity 129 member B) localizes in the cytoplasm and translocates to the adherens junctions in the presence of β-catenin. The protein contains a pleckstrin homology domain and a proline rich region. -
HPA024312-100UL
Sigma-Aldrich
Anti-FAM129B antibody produced in rabbit (C15-1450-721)
Price: $879.43List Price: $977.14Immunogen Niban-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA044019-100UL
Sigma-Aldrich
Anti-FAM149A antibody produced in rabbit (C15-1457-988)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to family with sequence similarity 149 member A Sequence LGLPPVSPRDCVKDAVAAEVFDHVWTNMVELLEELIRKHWETTLTEGKKQRETLKVAGNRFPHVLVPHAHADGASGPPSGHAEAHGISLASRLNPPQIHHFSSSF Application All Prestige Antibodies -
HPA055004-100UL
Sigma-Aldrich
Anti-FAM149A antibody produced in rabbit (C15-1461-859)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 149, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA039189-100UL
Sigma-Aldrich
Anti-FAM149B1 antibody produced in rabbit (C15-1455-613)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 149, member B1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a