Measuring and Observing and Testing Equipment

Immunogen G kinase anchoring protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the N terminal region of human GLI1 Application Anti-GLI1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 &#956g/ml.

Immunogen GLI family zinc finger 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to GLI family zinc finger 1 Sequence PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Gliadin is a protein found in wheat and other cereals. The T cells recognize the gliadin epitopes and activate the innate immune response similar to the response to pathogens.

Intermediate filaments (IFs) with characteristic 10 nm diameter are a distinct class of molecularly heterogenous cytoskeletal filaments defined by ultrastructural, immunological, and biochemical criteria. Intermediate filaments differ significantly

The GFAP (glial fibrillary acidic protein) gene encodes an intermediate protein filament-III (50kDa). It is localized particularly to the astrocytes and non-myelinating Schwann cells of the central and peripheral nervous system, respectively.

The GFAP (glial fibrillary acidic protein) gene encodes an intermediate protein filament-III (50kDa). It is localized particularly to the astrocytes and non-myelinating Schwann cells of the central and peripheral nervous system, respectively.

The GFAP (glial fibrillary acidic protein) gene encodes an intermediate protein filament-III (50kDa). It is localized particularly to the astrocytes and non-myelinating Schwann cells of the central and peripheral nervous system, respectively.

Immunogen GLI pathogenesis-related 1 like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen glomulin, FKBP associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen glomulin, FKBP associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are