Measuring and Observing and Testing Equipment

Immunogen glutamate receptor, ionotropic, AMPA 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen glutamate ionotropic receptor AMPA type subunit 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

GRIK2 is a ligand-gated, ion channel glutamate receptor that belongs to the kainite family. Genetic variations in GRIK2 have been linked to mental retardation, mania and obsessive compulsive disorder (OCD).

GRIK2 is a ligand-gated, ion channel glutamate receptor that belongs to the kainite family. Genetic variations in GRIK2 have been linked to mental retardation, mania and obsessive compulsive disorder (OCD).

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLuK1 to GLuK5.

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLUK1 to GLUK5.

Immunogen Synthetic peptide directed towards the N terminal region of human GRIK4 Application Anti-GRIK4 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions GRIK4 or glutamate

Immunogen Recombinant protein corresponding to glutamate ionotropic receptor kainate type subunit 5 Sequence KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY Application All Prestige Antibodies Powered by

Immunogen glutamate ionotropic receptor NMDA type subunit 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen glutamate receptor interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a