Measuring and Observing and Testing Equipment

HES-5 is a mammalian basic helix-loop-helix factor that has a distant sequence homology to the product of the Drosophila pair-rule gene hairy. HES-5 mRNA is present exclusively in the developing nervous system, but its level decreases as neural

Immunogen Recombinant protein corresponding to hes family bHLH transcription factor 1 Sequence PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen hes family bHLH transcription factor 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to hes family bHLH transcription factor 5 Sequence PSTVAVELLSPKEKNRLRKPVVEKMRRD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Synthetic peptide directed towards the C terminal region of human HES6 Biochem/physiol Actions HES6 belongs to a subfamily of basic helix-loop-helix transcription factors that includes Drosophila Hairy and Enhancer of split genes. Like

Immunogen hes family bHLH transcription factor 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen hes family bHLH transcription factor 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the middle region of human HES7 Application Anti-HES7 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. For immunohistochemistry of paraffin-embedded tissue

Immunogen hes family bHLH transcription factor 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen hexosaminidase subunit alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen hexosaminidase B (beta polypeptide) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen hexosaminidase B (beta polypeptide) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,