Measuring and Observing and Testing Equipment

Immunogen Recombinant protein corresponding to heat shock protein 90 alpha family class B member 1 Sequence EEDKDDEEKPKIEDVGSDEEDDSGKDK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Endoplasmin precursor recombinant protein epitope signature tag (PrEST) Sequence SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTA Application

Immunogen Endoplasmin precursor recombinant protein epitope signature tag (PrEST) Sequence WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTS Application All Prestige Antibodies Powered

HSPA12A (heat shock 70kDa protein 12A), along with HSPA12B, forms a subfamily of Hsp70 protein family. It is expressed in brain, heart, kidney and muscle.

Immunogen heat shock 70kDa protein 12A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Heat shock 70 kDa protein 12B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Heat shock 70 kDa protein 12B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

HSPA13 (heat shock protein 70kDa family, member 13) belongs to the heat shock protein 70 chaperone family. It has a highly conserved N-terminal domain, which contains the ATPase domain, and a unique hydrophobic leader sequence.

Immunogen heat shock 70kDa protein 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Heat shock 70 kDa protein 1A (HSPA1A, eHSP70, HSP72) is an environmental stress-inducible extracellular/plasma circulating heat shock protein that interacts with effector cells of the innate immune system. HSPA1A promotes the proliferation of H22

Immunogen heat shock 70kDa protein 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen heat shock 70kDa protein 1-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are