Measuring and Observing and Testing Equipment

Immunogen interleukin 1 receptor, type I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen interleukin 1 receptor, type I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen interleukin 4 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to interleukin 9 receptor Sequence LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to interleukin 9 receptor Sequence SNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

ILKAP (integrin-linked kinase-associated serine/threonine phosphatase) is a serine/threonine (S/T) protein phosphatase belonging to the PP2C family. Immunogen Integrin-linked kinase-associated serine/threonine phosphatase 2C recombinant protein

Immunogen Recombinant protein corresponding to integrin-linked kinase-associated serine/threonine phosphatase. Sequence

Monoclonal Anti-Importin &#945 (mouse IgG2b isotype) is derived from the hybridoma IM-75 produced by the fusion of mouse myeloma cells (NS1 cells), and splenocytes from BALB/c mice, immunized with recombinant human importin &#945. The Importin

INA (internexin neuronal intermediate filament protein, &#945) is also called as &#945-Internexin. The gene is mapped to human chromosome 10q24.

Immunogen inhibitor of CDK, cyclin A1 interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen inhibitor of CDK, cyclin A1 interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen inhibitor of growth family, member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive