Measuring and Observing and Testing Equipment

Immunogen Synthetic peptide directed towards the N terminal region of human ITGB1BP2 Biochem/physiol Actions ITGB1BP2 may play a role during maturation and/or organization of muscles cells. Sequence Synthetic peptide located within the following

Immunogen Integrin beta-2 precursor recombinant protein epitope signature tag (PrEST) Sequence CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML Application All Prestige Antibodies

Immunogen Integrin beta-2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Integrin subunit &#946 3 (ITGB3) is part of the integrin family whose members bind to proteins containing the arginine-glycine-aspartic acid (RGD)-motif. The ITGB3 protein is expressed in hematopoietic cells, endothelial cells, platelets and

Immunogen integrin &#946-3 binding protein (&#946-3-endonexin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen integrin, beta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen integrin, beta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

&#921ntegrins, heterodimeric trans-membrane matrix receptors, are mainly involved in the signal transduction and attachments to extra cellular matrix (ECM).†† In ECM they act as a mediator of cell adhesion.

Integrin subunit &#946 6 (ITGB6) is a &#946 subunit of integrin &#945v&#9466, which is a membrane-spanning heterodimeric glycoprotein. It is encoded by the gene mapped to human chromosome 2q24.

Immunogen integrin, beta 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Integrin, &#946-like 1 (with EGF-like repeat domains) (ITGBL1, TIED) is a &#946 integrin-related protein found in aorta, thymus and osteogenic sarcoma. Defects in ITGBL1 may be associated with isolated growth hormone deficiency.

Immunogen Synthetic peptide directed towards the N terminal region of human ITGBL1 Biochem/physiol Actions ITGBL1 may be linked in some way with the evolution of the integrin beta subunits. Sequence Synthetic peptide located within the following