Measuring and Observing and Testing Equipment

Integrin &#946-like protein (ITGBL1) contains 10 integrin-like cysteine-rich repeats. The gene encoding this protein is present on chromosome 13.

Immunogen inter-alpha (globulin) inhibitor H1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen inter-alpha (globulin) inhibitor H1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen inter-alpha-trypsin inhibitor heavy chain 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Inter-alpha-trypsin inhibitor heavy chain H3 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Inter-&#945-trypsin inhibitor heavy chain family, member 4 (ITIH4) is a 120kDa plasma glycoprotein with anti-inflammatory characteristics. It is the substrate for plasma kallikrein (PK) in liver.

Immunogen Transmembrane protein 110 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen inter-alpha-trypsin inhibitor heavy chain family, member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen IL2 inducible T cell kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Omentin (intelectin-1) is highly expressed in omental adipose tissue, small intestine and various other tissues. It is a plasma adipokine made up of 313 amino acids.

Immunogen Recombinant protein corresponding to intelectin 1 Sequence DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

ITLN2 (Intelectin 2) is a member of intelectin gene family expressed in small intestine. It is associated with various cellular processes, such as early embryogenesis, host-pathogen interactions, and iron metabolism.