Measuring and Observing and Testing Equipment

Lysosome-associated membrane protein 1 (LAMP1), also termed Igp120, is a heavily glycosylated lysosomal membrane protein of about 120 kDa. It consists of a ~40 kDa core polypeptide with O-linked and 18 asparagine-linked oligosaccharide side chains.

Immunogen lysosomal-associated membrane protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

LAMP5 (lysosomal-associated membrane protein family) is a transmembrane glycosylated protein. It is a member of LAMP family and expressed in the cortical neurons of particular layers.

Immunogen UPF0404 protein C11orf59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen UPF0539 protein C7orf59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Hepatitis B virus X-interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen LanC lantibiotic synthetase component C-like 1 (bacterial) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

LanC lantibiotic synthetase component C-like 3 (LANCL3) belongs to the LanC-like (LANCL) family of proteins, and shows similarity to lanthionine synthetase component C (LanC) proteins found in prokaryotes. In humans, there are three LANCL genes-

Immunogen Recombinant protein corresponding to LanC like 3 Sequence KLAQEVLTPAQIKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSDRELVWQSVDFLMEQE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen LAS1-like (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen LIM and SH3 domain protein 1 recombinant protein epitope signature tag (PrEST) Application Anti-LASP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

LAX (linker for activation of X cells) is a transmembrane adaptor protein that expressed in B cells, T cells, NK cells, mast cells, platelets and other lymphoid-specific cell types. It acts as a typical heavy raft" protein."