-
HPA003887-100UL
Sigma-Aldrich
Anti-LAX1 antibody produced in rabbit (C15-1446-080)
Price: $879.43List Price: $977.14Immunogen Lymphocyte transmembrane adapter 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040087-100ULImmunogen layilin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA034669-100ULThe limb-bud and heart (LBH) gene is mapped to human chromosome 2p23.1.
-
HPA049840-100UL
Sigma-Aldrich
Anti-LBR antibody produced in rabbit (C15-1460-090)
Price: $928.29List Price: $1,031.43LBR (lamin B receptor) is a transmembrane protein, that has a nucleoplasmic amino-terminal domain, eight transmembrane domains and a small carboxyl-terminal region. It is present on the inner nuclear membrane. -
HPA062236-100UL
Sigma-Aldrich
Anti-LBR antibody produced in rabbit (C15-1464-027)
Price: $928.29List Price: $1,031.43Immunogen lamin B receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA055919-100ULImmunogen lipocalin 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA060941-100ULImmunogen Recombinant protein corresponding to lipocalin 9 Sequence AQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
-
HPA031428-100UL
Sigma-Aldrich
Anti-LCOR antibody produced in rabbit (C15-1453-116)
Price: $889.20List Price: $988.00Immunogen ligand dependent nuclear receptor corepressor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA057621-100UL
Sigma-Aldrich
Anti-LCOR antibody produced in rabbit (C15-1462-712)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ligand dependent nuclear receptor corepressor Sequence NSEEGNTCIIPQRNLFKALSEEAWNSGFMGNSSRTADKENTLQCPKTPLRQDLEANEQDARPKQENHLHSLGRNKVGYHLHPSDKGQFD Application All Prestige Antibodies Powered by Atlas -
HPA077000-100UL
Sigma-Aldrich
Anti-LCOR antibody produced in rabbit (C15-1466-976)
Price: $928.29List Price: $1,031.43Immunogen ligand dependent nuclear receptor corepressor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028794-100UL
Sigma-Aldrich
Anti-LCORL antibody produced in rabbit (C15-1452-006)
Price: $879.43List Price: $977.14Immunogen ligand dependent nuclear receptor corepressor-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA028795-100UL
Sigma-Aldrich
Anti-LCORL antibody produced in rabbit (C15-1452-007)
Price: $879.43List Price: $977.14Immunogen ligand dependent nuclear receptor corepressor-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and