-
Add to Cart The item has been addedHPA061745-100ULSigma-Aldrich
Anti-LIN28B antibody produced in rabbit (C15-1463-898)
Price: $928.29List Price: $1,031.43Immunogen lin-28 homolog B (C. elegans) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA043253-100ULSigma-Aldrich
Anti-LIN37 antibody produced in rabbit (C15-1457-598)
Price: $928.29List Price: $1,031.43Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA047809-100ULSigma-Aldrich
Anti-LIN37 antibody produced in rabbit (C15-1459-341)
Price: $928.29List Price: $1,031.43Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071562-100ULImmunogen Recombinant protein corresponding to lin-7 homolog A, crumbs cell polarity complex component Sequence EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA051118-100ULImmunogen lin-7 homolog C (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA030241-100ULImmunogen lin-9 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA068733-100ULImmunogen long intergenic non-protein coding RNA 493 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA074653-100ULImmunogen leucine rich repeat and Ig domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA016633-100ULImmunogen Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA060781-100ULImmunogen leucine rich repeat and Ig domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA038578-100ULSigma-Aldrich
Anti-LINS1 antibody produced in rabbit (C15-1455-329)
Price: $928.29List Price: $1,031.43Immunogen lines homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA038579-100ULSigma-Aldrich
Anti-LINS1 antibody produced in rabbit (C15-1455-330)
Price: $928.29List Price: $1,031.43Immunogen lines homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
