-
HPA007318-100UL
Sigma-Aldrich
Anti-MS4A8 antibody produced in rabbit (C15-1446-869)
Price: $879.43List Price: $977.14Immunogen Membrane-spanning 4-domains subfamily A member 8B recombinant protein epitope signature tag (PrEST) Sequence MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK Application All Prestige Antibodies Powered by Atlas -
HPA007319-100UL
Sigma-Aldrich
Anti-MS4A8 antibody produced in rabbit (C15-1446-870)
Price: $879.43List Price: $977.14MS4A8 (membrane-spanning 4-domains, subfamily A, member 8) gene encodes a protein belonging to the MS4A family of proteins that are characterized by common structural features and similar intron/exon splice boundaries. Their expression pattern is -
HPA017172-100ULImmunogen Mesothelin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA000272-100ULImmunogen Macrophage scavenger receptor types I and II recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA007657-100UL
Sigma-Aldrich
Anti-MST1R antibody produced in rabbit (C15-1446-952)
Price: $879.43List Price: $977.14MST1R (macrophage stimulating 1 receptor) is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung. It is a single-chain precursor that is cleaved to form a mature dimer protein comprising of disulfide-linked α -
HPA008180-100UL
Sigma-Aldrich
Anti-MST1R antibody produced in rabbit (C15-1447-070)
Price: $879.43List Price: $977.14Macrophage-stimulating protein receptor (MST1R) belongs to the MET receptor tyrosine kinase family. It is expressed in keratinocytes and macrophages. -
HPA039433-100ULImmunogen metastasis associated 1 family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA010932-100UL
Sigma-Aldrich
Anti-MTDH antibody produced in rabbit (C15-1447-482)
Price: $879.43List Price: $977.14MTDH is an oncogene that aids cancer progression. It is involved in a broad range of cellular functions such as apoptosis evasion, metastasis, drug resistance, cell movement and transformation. -
HPA015104-100UL
Sigma-Aldrich
Anti-MTDH antibody produced in rabbit (C15-1448-304)
Price: $879.43List Price: $977.14MTDH (metadherin) is a transmembrane protein, which spans the membrane once, and has a molecular weight of 64kDa. It is also called astrocyte elevated gene-1 (AEG-1) and lysine-rich CEACAM1 coisolated (LYRIC). -
HPA044894-100UL
Sigma-Aldrich
Anti-MTERF1 antibody produced in rabbit (C15-1458-327)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial transcription termination factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA069560-100UL
Sigma-Aldrich
Anti-MTERF1 antibody produced in rabbit (C15-1465-704)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial transcription termination factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA003526-100ULImmunogen mitochondrial transcription termination factor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive