-
Add to Cart The item has been addedHPA027097-100ULImmunogen mitochondrial transcription termination factor 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA040710-100ULImmunogen mitochondrial methionyl-tRNA formyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA018502-100ULThe gene MTMR1 (myotubularin-related protein 1) is mapped to human chromosome Xq28. It belongs to protein-tyrosine phosphatase family. -
Add to Cart The item has been addedHPA006081-100ULImmunogen myotubularin related protein 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA030351-100ULSigma-Aldrich
Anti-MTMR11 antibody produced in rabbit (C15-1452-662)
Price: $879.43List Price: $977.14Immunogen myotubularin related protein 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA072906-100ULSigma-Aldrich
ANTI-MTMR11 ANTIBODY PRODUCED IN RABBIT (C15-1466-281)
Price: $977.14List Price: $1,085.71Immunogen myotubularin related protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA051333-100ULImmunogen myotubularin related protein 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA054063-100ULImmunogen myotubularin related protein 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA070944-100ULImmunogen myotubularin related protein 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA071227-100ULImmunogen mechanistic target of rapamycin (serine/threonine kinase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedAV48473-100ULSigma-Aldrich
Anti-MTR antibody produced in rabbit (C15-1341-697)
Price: $898.29List Price: $998.10MTR codes for 5-methyltetrahydrofolate-homocysteine methyltransferase that catalyzes the last step in methionine synthesis. Genetic alterations in MTR have been associated with methylcobalamin deficiency, breast cancer risk and prostate cancer -
Add to Cart The item has been addedHPA054915-100ULSigma-Aldrich
Anti-MTR antibody produced in rabbit (C15-1461-832)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to 5-methyltetrahydrofolate-homocysteine methyltransferase Sequence DIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLI Application All Prestige Antibodies Powered by Atlas
