Measuring and Observing and Testing Equipment

Immunogen neurobeachin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Norrin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

NDST4 (N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) is the fourth member of NDST family, and shows high sequence homology to the other three members namely, NDST1, NDST2 and NDST3. It is made of 872 amino acids.

Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen NADH dehydrogenase (ubiquinone) 1&#946-subcomplex subunit 8, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen NADH:ubiquinone oxidoreductase subunit B8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene NDUFS8 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8 - mitochondrial) is mapped to human chromosome 11q13. It is a nuclear encoded gene and is localized in the mitochondria.

Immunogen NADH:ubiquinone oxidoreductase core subunit S8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Neural precursor cell expressed, developmentally down-regulated 1 (NEDD1) is also known as &#947 complex proteins (GCPs)-WD. NEDD1 is mapped to human chromosome 12q23.

Immunogen Recombinant protein corresponding to neural precursor cell expressed, developmentally down-regulated 8 Sequence TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL Application All Prestige Antibodies Powered by Atlas Antibodies