-
Add to Cart The item has been addedHPA046867-100ULSigma-Aldrich
Anti-NSUN5 antibody produced in rabbit (C15-1459-039)
Price: $928.29List Price: $1,031.43Immunogen NOP2/Sun domain family, member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA020653-100ULNOL1/NOP2/Sun domain family member 7 (NSUN7) protein is homologous to rRNA and tRNA cytosine methyltransferases. The gene encoding it is localized on human chromosome 4. -
Add to Cart The item has been addedHPA046856-100ULImmunogen 5′-nucleotidase domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA017357-100ULNT5E (5′-nucleotidase, ecto, CD73) is a glycosyl-phosphatidylinositol-linked plasma membrane glycoprotein encoding a protein, ecto-5′-nucleotidase (CD73), which acts as the major enzymatic source of extracellular adenosine. It is -
Add to Cart The item has been addedHPA043777-100ULImmunogen 5′,3′-nucleotidase, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA050817-100ULImmunogen netrin 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA065954-100ULImmunogen netrin G1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA065089-100ULSigma-Aldrich
Anti-NTNG2 antibody produced in rabbit (C15-1464-811)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to netrin G2 Sequence DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA071290-100ULSigma-Aldrich
Anti-NTNG2 antibody produced in rabbit (C15-1466-020)
Price: $928.29List Price: $1,031.43Immunogen netrin G2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA035799-100ULImmunogen neurotrophic tyrosine kinase, receptor, type 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA074873-100ULImmunogen neurotrophic receptor tyrosine kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA027484-100ULSigma-Aldrich
Anti-NTRK3 antibody produced in rabbit (C15-1451-517)
Price: $879.43List Price: $977.14Immunogen neurotrophic tyrosine kinase, receptor, type 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
