-
HPA061910-100UL
Sigma-Aldrich
Anti-NUP85 antibody produced in rabbit (C15-1463-938)
Price: $928.29List Price: $1,031.43Immunogen nucleoporin 85kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA062595-100UL
Sigma-Aldrich
Anti-NUP85 antibody produced in rabbit (C15-1464-122)
Price: $928.29List Price: $1,031.43Immunogen nucleoporin 85kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA021816-100ULNUP88 (Nucleoporin 88kDa) is an 88kDa non-FG nucleoporin. It acts as a component of novel nuclear pore complex (NPC).
-
HPA017937-100ULNucleoporin 93kDa (NUP93) is one among the nuclear pore proteins. The gene encoding this protein is localized to human chromosome 16.
-
AV53631-100UL
Sigma-Aldrich
Anti-NUP98 antibody produced in rabbit (C15-1341-877)
Price: $898.29List Price: $998.10Nuclear pore complex protein is a protein encoded by the nucleoporin 98 kDa (NUP98) gene in humans. NUP98 gene encodes a peripheral membrane protein nucleoporin that belongs to nucleoporin GLFG family. -
HPA074810-100UL
Sigma-Aldrich
Anti-NUP98 antibody produced in rabbit (C15-1466-618)
Price: $928.29List Price: $1,031.43Immunogen nucleoporin 98kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA042904-100UL
Sigma-Aldrich
Anti-NUSAP1 antibody produced in rabbit (C15-1457-428)
Price: $928.29List Price: $1,031.43Immunogen nucleolar and spindle associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA074847-100UL
Sigma-Aldrich
Anti-NUSAP1 antibody produced in rabbit (C15-1466-629)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to nucleolar and spindle associated protein 1 Sequence THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ Application All Prestige Antibodies Powered by Atlas -
HPA040915-100UL
Sigma-Aldrich
Anti-NUTF2 antibody produced in rabbit (C15-1456-423)
Price: $928.29List Price: $1,031.43Immunogen nuclear transport factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040956-100UL
Sigma-Aldrich
Anti-NUTF2 antibody produced in rabbit (C15-1456-446)
Price: $928.29List Price: $1,031.43Immunogen nuclear transport factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040421-100ULImmunogen chromosome 15 open reading frame 55 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA047471-100ULImmunogen nuclear transport factor 2-like export factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive