Measuring and Observing and Testing Equipment

OLIG2 (oligodendrocyte lineage transcription factor 2) is a transcription factor (TF) belonging to the basic-helix-loop-helix (bHLH) TF family. It is expressed in human glioblastoma and neural progenitor cells.

Immunogen Synthetic peptide directed towards the N terminal region of human OLR1 Application Anti-OLR1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml.

Immunogen oxidized low density lipoprotein (lectin-like) receptor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to osteomodulin Sequence PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Oligodendrocyte-myelin glycoprotein precursor recombinant protein epitope signature tag (PrEST) Sequence

The gene encoding oligodendrocyte-myelin glycoprotein (OMG) occupies 2.7kb of genomic DNA.

Immunogen Hepatocyte nuclear factor 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the middle region of human ONECUT2 Biochem/physiol Actions ONECUT2 belongs to onecut family of transcription factors that regulate melanocyte and hepatocyte differentiation. Sequence Synthetic peptide

Immunogen one cut homeobox 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen placenta-specific 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Oligophrenin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Recombinant protein corresponding to opioid receptor delta 1 Sequence LQPPLFANASDAYPSAFPSAGANASGPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as