Measuring and Observing and Testing Equipment

Immunogen Recombinant protein corresponding to opioid receptor kappa 1 Sequence RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

The gene OPRM1 (opioid receptor &#956 1) is mapped to human chromosome 6q24-q25. The gene spanning a length of 200kb contains 11 exons that yield 17 splice variants.

Immunogen olfactory receptor, family 10, subfamily A, member 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen olfactory receptor, family 10, subfamily AD, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

OR10G3 (Olfactory receptor, family 10, subfamily G, member 3) is a seven-transmembrane domain G protein-coupled receptor belonging to a large family of olfactory receptors (ORs). It is expressed on olfactory sensory neurons in the olfactory

Immunogen olfactory receptor, family 10, subfamily K, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen olfactory receptor, family 10, subfamily R, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen olfactory receptor, family 10, subfamily R, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene OR10S1 (olfactory receptor 10S1) is mapped to human chromosome 11q24.2.

Immunogen olfactory receptor, family 10, subfamily V, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen olfactory receptor, family 10, subfamily Z, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen olfactory receptor, family 11, subfamily H, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive