-
HPA027380-100UL
Sigma-Aldrich
Anti-OXR1 antibody produced in rabbit (C15-1451-464)
Price: $879.43List Price: $977.14Immunogen oxidation resistance 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA027395-100UL
Sigma-Aldrich
Anti-OXR1 antibody produced in rabbit (C15-1451-468)
Price: $879.43List Price: $977.14Immunogen oxidation resistance 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA021293-100UL
Sigma-Aldrich
Anti-OXSM antibody produced in rabbit (C15-1449-819)
Price: $879.43List Price: $977.14OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
HPA021300-100UL
Sigma-Aldrich
Anti-OXSM antibody produced in rabbit (C15-1449-822)
Price: $879.43List Price: $977.14OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
HPA021337-100UL
Sigma-Aldrich
Anti-OXSM antibody produced in rabbit (C15-1449-839)
Price: $879.43List Price: $977.14OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
HPA071892-100ULImmunogen Recombinant protein corresponding to oxytocin/neurophysin I prepropeptide Sequence ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
-
HPA039494-100ULImmunogen purinergic receptor P2X, ligand-gated ion channel, 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project
-
AV35518-100UL
Sigma-Aldrich
Anti-P2RX7 antibody produced in rabbit (C15-1340-961)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human P2RX7 Biochem/physiol Actions The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for -
HPA034967-100UL
Sigma-Aldrich
Anti-P2RX7 antibody produced in rabbit (C15-1453-619)
Price: $889.20List Price: $988.00Immunogen purinergic receptor P2X, ligand-gated ion channel, 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA034968-100UL
Sigma-Aldrich
Anti-P2RX7 antibody produced in rabbit (C15-1453-620)
Price: $889.20List Price: $988.00Immunogen purinergic receptor P2X, ligand-gated ion channel, 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA042013-100UL
Sigma-Aldrich
Anti-P2RX7 antibody produced in rabbit (C15-1457-013)
Price: $928.29List Price: $1,031.43Immunogen purinergic receptor P2X, ligand gated ion channel, 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA044141-100UL
Sigma-Aldrich
Anti-P2RX7 antibody produced in rabbit (C15-1458-043)
Price: $928.29List Price: $1,031.43Immunogen purinergic receptor P2X, ligand-gated ion channel, 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project