Measuring and Observing and Testing Equipment

Immunogen phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

PAK1 (p21 activated kinase 1) is a Ser/Thr kinase protein, and is a member of the evolutional conserved PAKs, which consists of six members. PAKs are divided into two groups- group I and II.

Immunogen Recombinant protein corresponding to PAK1 interacting protein 1 Sequence GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen PAK1 interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen p21 protein (Cdc42/Rac)-activated kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen p21 protein (Cdc42/Rac)-activated kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen p21 protein (Cdc42/Rac)-activated kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

p21 protein (Cdc42/Rac)-activated kinase 7 (PAK7) is part of the Rac (ras-related protein)/Cdc42 (cell division cycle 42)-associated serine/threonine protein kinase family. It is expressed in the brain and contains regulatory and kinase domains.

Immunogen paralemmin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen paralemmin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen paralemmin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The