Measuring and Observing and Testing Equipment

PARL (Presenilin associated, rhomboid-like) is a nuclear modifier gene expressed in both outer and inner mitochondrial membranes. Immunogen presenilin associated rhomboid like recombinant protein epitope signature tag (PrEST) Application All

Immunogen prostate androgen-regulated mucin-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Poly(A)-specific ribonuclease (PARN) is a 3&#8242- exoribonuclease found in mammals. It is a member of the DEDD (death effector domain-containing protein) family of nucleases, and is a divalent metal-ion dependent enzyme.

Immunogen Poly(A)-specific ribonuclease PARN recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the C terminal region of human PARP1 Biochem/physiol Actions PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation.

Immunogen poly (ADP-ribose) polymerase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen poly (ADP-ribose) polymerase family, member 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen poly (ADP-ribose) polymerase family, member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human PARP11 Biochem/physiol Actions The PARP11 gene is part of the poly (ADP-ribose) polymerase family. Sequence Synthetic peptide located within the following region:

Immunogen Poly recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Poly(ADP-ribose) polymerase 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Poly [ADP-ribose] polymerase 14 recombinant protein epitope signature tag (PrEST) Sequence RYFLLCHSSLLDHLLTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSPEIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALL Application All Prestige Antibodies