Measuring and Observing and Testing Equipment

Immunogen parvin, gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen parvin, gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

PASD1 (PAS domain containing 1) is a cancer testis antigen (CTA), and is located on human chromosome Xq28. It has two alternatively spliced variants called PASD1_v1 and PASD1_v2.

PASD1 (PAS domain containing 1) is a cancer testis antigen (CTA), and is located on human chromosome Xq28. It has two alternatively spliced variants called PASD1_v1 and PASD1_v2.

Immunogen PAS domain-containing serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

The gene PASK (PAS domain-containing serine/threonine-protein kinase) is mapped to human chromosome 2q37. The protein is present in the cytoplasm as well as nucleus.

Immunogen Recombinant protein corresponding to prostate and testis expressed 1 Sequence LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen prostate and testis expressed 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen PATJ, crumbs cell polarity complex component recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen PATJ, crumbs cell polarity complex component recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen PATJ, crumbs cell polarity complex component recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein associated with topoisomerase II homolog 1 (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)