Measuring and Observing and Testing Equipment

Immunogen protocadherin gamma subfamily A, 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen protocadherin gamma subfamily A, 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to protocadherin gamma subfamily A, 2 Sequence PNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK Application All Prestige Antibodies

Immunogen Recombinant protein corresponding to protocadherin gamma subfamily A, 2 Sequence ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen family with sequence similarity 113, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen family with sequence similarity 113, member B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen PCF11 cleavage and polyadenylation factor subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen PDX1 C-terminal inhibiting factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Phosphoenolpyruvate carboxykinase, cytosolic [GTP] recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

PCK1 (phosphoenolpyruvate carboxykinase 1) is a widely expressed protein, and is expressed in multiple organs including brain. It is involved in gluconeogenesis in both liver and kidney.

Immunogen phosphoenolpyruvate carboxykinase 2 (mitochondrial) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Phosphoenolpyruvate carboxykinase 2, mitochondrial (PCK2) is expressed in liver, kidney, intestine, pancreas and fibroblasts. It has another cytosolic form known as PCK1.