Measuring and Observing and Testing Equipment

Immunogen period circadian regulator 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen period circadian clock 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Period circadian protein homolog 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

PERM1 (PPARGC1(Peroxisome proliferator-activated receptor &#947 coactivator 1-&#945) and ESRR induced regulator, muscle 1) codes for PGC-1 (proliferator-activated receptor &#947 coactivator 1)/ERR (estrogen-related receptor)-induced regulator in

PGC-1/ERR-induced regulator in muscle 1 (PERM1), a cytoplasmic protein is coded by Perm1 gene. It is present in multiple cellular compartments and is expressed in muscle.

PERP is a plasma membrane protein belonging to the PMP-22/gas3 family. Immunogen p53 apoptosis effector related to PMP-22 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen pescadillo ribosomal biogenesis factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen pescadillo ribosomal biogenesis factor 1 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) Features and Benefits Prestige

Immunogen pescadillo ribosomal biogenesis factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to PET100 homolog Sequence ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Peroxisomal biogenesis factor 1 (PEX1) belongs to the ATPases associated with diverse cellular activities (AAA) family of proteins and possesses two ATPase domains. It has a molecular weight of 147kDa.

Immunogen Synthetic peptide directed towards the middle region of human PEX10 Biochem/physiol Actions PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane.