-
HPA030156-100ULImmunogen protein kinase (cAMP-dependent, catalytic) inhibitor beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
-
HPA042703-100UL
Sigma-Aldrich
Anti-PKIG antibody produced in rabbit (C15-1457-331)
Price: $928.29List Price: $1,031.43Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA063690-100UL
Sigma-Aldrich
Anti-PKIG antibody produced in rabbit (C15-1464-451)
Price: $928.29List Price: $1,031.43Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA029501-100ULImmunogen pyruvate kinase, muscle recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA003982-100ULImmunogen Serine/threonine-protein kinase N1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA034861-100UL
Sigma-Aldrich
Anti-PKN2 antibody produced in rabbit (C15-1453-593)
Price: $889.20List Price: $988.00Immunogen protein kinase N2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA057913-100UL
Sigma-Aldrich
Anti-PKN2 antibody produced in rabbit (C15-1462-780)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to protein kinase N2 Sequence ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA045390-100UL
Sigma-Aldrich
Anti-PKN3 antibody produced in rabbit (C15-1458-498)
Price: $928.29List Price: $1,031.43Immunogen protein kinase N3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA058305-100UL
Sigma-Aldrich
Anti-PKN3 antibody produced in rabbit (C15-1462-902)
Price: $928.29List Price: $1,031.43Immunogen protein kinase N3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA027221-100UL
Sigma-Aldrich
Anti-PKP1 antibody produced in rabbit (C15-1451-373)
Price: $879.43List Price: $977.14Immunogen plakophilin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA027589-100UL
Sigma-Aldrich
Anti-PKP1 antibody produced in rabbit (C15-1451-568)
Price: $879.43List Price: $977.14Immunogen plakophilin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA066647-100UL
Sigma-Aldrich
Anti-PKP4 antibody produced in rabbit (C15-1465-113)
Price: $928.29List Price: $1,031.43Immunogen plakophilin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The