-
Add to Cart The item has been addedHPA017327-100ULSigma-Aldrich
Anti-PLK4 antibody produced in rabbit (C15-1448-739)
Price: $879.43List Price: $977.14Immunogen polo-like kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA035026-100ULSigma-Aldrich
Anti-PLK4 antibody produced in rabbit (C15-1453-649)
Price: $928.29List Price: $1,031.43Immunogen polo-like kinase 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043198-100ULSigma-Aldrich
Anti-PLK4 antibody produced in rabbit (C15-1457-567)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to polo like kinase 4 Sequence CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA035024-100ULImmunogen polo-like kinase 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA041862-100ULImmunogen plasmolipin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA026900-100ULImmunogen Cardiac phospholamban recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA049137-100ULSigma-Aldrich
Anti-PLOD1 antibody produced in rabbit (C15-1459-838)
Price: $928.29List Price: $1,031.43Immunogen procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA055799-100ULSigma-Aldrich
Anti-PLOD1 antibody produced in rabbit (C15-1462-131)
Price: $928.29List Price: $1,031.43Immunogen procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA001236-100ULImmunogen Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA004128-100ULProteolipid protein 1 (PLP1) gene encodes for two major proteins of the central nervous system (CNS) myelin, such as proteolipid protein (PLP) and DM20. This gene is located on the human chromosome at Xq22. -
Add to Cart The item has been addedHPA047815-100ULImmunogen phospholipid phosphatase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA055540-100ULImmunogen phospholipid phosphatase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
