-
HPA028892-100UL
Sigma-Aldrich
Anti-PLPP3 antibody produced in rabbit (C15-1452-044)
Price: $879.43List Price: $977.14PPAP2B (phosphatidic-acid-phosphatase-type-2B) is an integral membrane protein. It is also known as lipid phosphate phosphatases 3 (LPP3). -
HPA072751-100UL
Sigma-Aldrich
Anti-PLPP3 antibody produced in rabbit (C15-1466-276)
Price: $928.29List Price: $1,031.43Immunogen phospholipid phosphatase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA055777-100ULImmunogen phospholipid phosphatase 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA070252-100ULImmunogen phospholipid phosphatase 7 (inactive) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA014968-100ULLPPR1 (lipid phosphate phosphatase-related protein type 1) is also called plasticity-related gene-3 (PRG-3), and belongs to a family of phospholipid ectophosphatases called PRG. It is predominantly expressed in the brain and shows a development
-
HPA048973-100ULImmunogen phospholipid phosphatase related 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA052293-100UL
Sigma-Aldrich
Anti-PLPPR3 antibody produced in rabbit (C15-1460-971)
Price: $928.29List Price: $1,031.43Immunogen phospholipid phosphatase related 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA057034-100UL
Sigma-Aldrich
Anti-PLPPR3 antibody produced in rabbit (C15-1462-533)
Price: $928.29List Price: $1,031.43Immunogen phospholipid phosphatase related 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA018072-100UL
Sigma-Aldrich
Anti-PLPPR5 antibody produced in rabbit (C15-1448-910)
Price: $879.43List Price: $977.14Phospholipid phosphatase related 5 (LPPR5) is an integral membrane protein which has six transmembrane domains and a carboxy terminal facing the cytosol. It is mainly expressed in the brain. -
HPA059085-100UL
Sigma-Aldrich
Anti-PLPPR5 antibody produced in rabbit (C15-1463-139)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to phospholipid phosphatase related 5 Sequence PNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA035931-100UL
Sigma-Aldrich
Anti-PLRG1 antibody produced in rabbit (C15-1454-094)
Price: $928.29List Price: $1,031.43Immunogen pleiotropic regulator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA035932-100UL
Sigma-Aldrich
Anti-PLRG1 antibody produced in rabbit (C15-1454-095)
Price: $928.29List Price: $1,031.43Immunogen pleiotropic regulator 1 (PRL1 homolog, Arabidopsis) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and