Measuring and Observing and Testing Equipment

Immunogen Periostin precursor recombinant protein epitope signature tag (PrEST) Application Anti-POSTN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested

Immunogen protection of telomeres 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

POTE ankyrin domain family, member E (POTEE), also called prostate, ovary, testis-expressed protein belongs to POTE family. It is expressed in placenta, ovary, testis and prostate.

Immunogen POU class 1 homeobox 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen POU class 1 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen POU class 3 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen POU class 3 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the C terminal region of human POU3F4 Sequence Synthetic peptide located within the following region: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL Physical form Purified antibody supplied in 1x PBS

Immunogen POU class 3 homeobox 4 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1 paper)

Immunogen Recombinant protein corresponding to POU class 3 homeobox 4 Sequence SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Synthetic peptide directed towards the C terminal region of human POU4F1 Biochem/physiol Actions POU4F1 is a neural transcription factor that is involved in the development of sensory nervous system. POU domain factors are characterized

Immunogen Synthetic peptide directed towards the middle region of human POU4F3 Biochem/physiol Actions POU4F3 is capable of activating both BDNF and NT-3 promoters in inner ear sensory epithelial cell lines. Mutant POU4F3 loses most of its