Measuring and Observing and Testing Equipment

Immunogen protein phosphatase 1, regulatory (inhibitor) subunit 14D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Protein phosphatase 1 regulatory subunit 15A (PPP1R15A) is the regulatory subunit of eukaryotic translation initiation factor 2 &#945 (eIF2&#945) phosphatase. It is expressed when there is a signal indicating endoplasmic reticulum stress.

Immunogen protein phosphatase 1, regulatory subunit 15B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Protein phosphatase 1 regulatory subunit 16A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein phosphatase 1 regulatory subunit 16B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene PPP1R17 (protein phosphatase 1 regulatory subunit 17) is mapped to human chromosome 7p15. The gene encodes for a cGMP (cyclic guanosine monophosphate) dependent protein kinase.

Immunogen Recombinant protein corresponding to protein phosphatase 1 regulatory subunit 17 Sequence PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen protein phosphatase 1, regulatory subunit 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein phosphatase 1, regulatory subunit 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein phosphatase 1, regulatory (inhibitor) subunit 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen protein phosphatase 1, regulatory (inhibitor) subunit 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen protein phosphatase 1, regulatory (inhibitor) subunit 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most