-
HPA027406-100UL
Sigma-Aldrich
Anti-PPP1R8 antibody produced in rabbit (C15-1451-476)
Price: $879.43List Price: $977.14Immunogen Nuclear inhibitor of protein phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027417-100UL
Sigma-Aldrich
Anti-PPP1R8 antibody produced in rabbit (C15-1451-480)
Price: $879.43List Price: $977.14Immunogen Nuclear inhibitor of protein phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027452-100UL
Sigma-Aldrich
Anti-PPP1R8 antibody produced in rabbit (C15-1451-505)
Price: $879.43List Price: $977.14The gene PPP1R8 (protein phosphatase 1 regulatory inhibitor subunit 8) is mapped to human chromosome 1p35. The encoded protein has a PP1 (protein phosphatase 1)-anchoring domain, a forkhead-associated (FHA) domain and a PP1-inhibitory domain. -
HPA027726-100UL
Sigma-Aldrich
Anti-PPP1R9A antibody produced in rabbit (C15-1451-589)
Price: $879.43List Price: $977.14Immunogen Neurabin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA075591-100UL
Sigma-Aldrich
Anti-PPP1R9A antibody produced in rabbit (C15-1466-759)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to protein phosphatase 1 regulatory subunit 9A Sequence KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA043236-100ULImmunogen protein phosphatase 2, catalytic subunit, alpha isozyme Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA018908-100ULThe gene protein phosphatase 2A subunit A isoform R1-β (PPP2R1B) is mapped to human chromosome 11q22-23. It belongs to the huntington-elongation-A subunit-TOR (HEAT) repeat protein family.
-
HPA038118-100UL
Sigma-Aldrich
Anti-PPP2R2B antibody produced in rabbit (C15-1455-076)
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 2, regulatory subunit B, beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA042122-100UL
Sigma-Aldrich
Anti-PPP2R2B antibody produced in rabbit (C15-1457-074)
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 2, regulatory subunit B, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA042770-100ULImmunogen protein phosphatase 2, regulatory subunit B, delta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA035829-100UL
Sigma-Aldrich
Anti-PPP2R3A antibody produced in rabbit (C15-1454-031)
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 2 (formerly 2A), regulatory subunit B′′, alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA035830-100UL
Sigma-Aldrich
Anti-PPP2R3A antibody produced in rabbit (C15-1454-032)
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 2 (formerly 2A), regulatory subunit B′′, alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human