-
Add to Cart The item has been addedHPA039212-100ULImmunogen proline-rich coiled-coil 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA046791-100ULImmunogen proline-rich coiled-coil 2A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA060566-100ULImmunogen proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA063566-100ULImmunogen Recombinant protein corresponding to paired related homeobox 1 Sequence NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA006607-100ULSigma-Aldrich
Anti-PRRX2 antibody produced in rabbit (C15-1446-675)
Price: $879.43List Price: $977.14Immunogen paired related homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA026808-100ULSigma-Aldrich
Anti-PRRX2 antibody produced in rabbit (C15-1451-213)
Price: $879.43List Price: $977.14Paired related homeobox 2 (PRRX2) is a member of PRRX gene family, which is encoded by a gene mapped to human chromosome 9q34.1. -
Add to Cart The item has been addedHPA063471-100ULImmunogen protease, serine, 1 (trypsin 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA058082-100ULImmunogen protease, serine, 33 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA028003-100ULSigma-Aldrich
Anti-PRSS38 antibody produced in rabbit (C15-1451-681)
Price: $879.43List Price: $977.14Immunogen Serine protease MPN2 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA055809-100ULSigma-Aldrich
Anti-PRSS38 antibody produced in rabbit (C15-1462-138)
Price: $928.29List Price: $1,031.43Immunogen protease, serine, 38 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA060284-100ULImmunogen protease, serine, 45 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA030436-100ULImmunogen protease, serine, 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
