Measuring and Observing and Testing Equipment

PTDSR is a nuclear protein that has a JmjC domain. This protein has been shown to function as a lysyl-5-hydroxylase that is involved in alternative RNA splicing.

Immunogen Phosphatidylserine synthase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen phosphotriesterase related Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen phosphotriesterase related recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene PTGIS (prostaglandin I2 synthase) encodes a protein belonging to the cytochrome P450 superfamily of enzymes. The encoded protein is also referred to as prostacyclin synthase.

Immunogen Recombinant protein corresponding to prostaglandin I2 synthase Sequence GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR Application All Prestige

Immunogen parathyroid hormone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

PTH1R (parathyroid hormone 1 receptor) gene encodes a member of the G-protein coupled receptor family B or secretin family GPCRs. These receptors have an N-terminal extracellular domain (ECD) spanning a length of 160 amino acids and a 7-TM domain.

Immunogen parathyroid hormone 1 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen parathyroid hormone 2 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen prothymosin, alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen pleiotrophin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The