Measuring and Observing and Testing Equipment

The gene PTPN7 (tyrosine-protein phosphatase non-receptor type 7) is mapped to human chromosome 1q32.1.

Immunogen protein tyrosine phosphatase, non-receptor type 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen protein tyrosine phosphatase, receptor type, G Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Receptor-type tyrosine-protein phosphatase N2 precursor recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given

Immunogen Receptor-type tyrosine-protein phosphatase N2 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

PTPRZ1 (protein tyrosine phosphatase, receptor-type, Z polypeptide 1) is a transmembrane protein, which belongs to the receptor-type PTP (RPTP) protein subfamily, the members of which resemble cell adhesion molecules. This protein has three

PTRHD1 (Peptidyl-tRNA hydrolase domain containing 1) is located on chromosome 2p23. Its function is unknown.

Immunogen Securin recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for

Immunogen pituitary tumor-transforming 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Pentraxin-3 (PTX-3) is an acute-phase protein a soluble pattern recognition receptor, expressed in dendritic cells, monocytes, endothelial cells or neutrophils, at the time of inflammatory processes. It represents the long pentraxin subfamily.

Immunogen Recombinant protein corresponding to pseudouridine 5&#8242-phosphatase Sequence LVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGEPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPD Application All Prestige

Immunogen poly-U binding splicing factor 60KDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive