-
Add to Cart The item has been addedHPA024235-100ULSigma-Aldrich
Anti-RABEP1 antibody produced in rabbit (C15-1450-687)
Price: $879.43List Price: $977.14Immunogen Rab GTPase-binding effector protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA024691-100ULSigma-Aldrich
Anti-RABEP1 antibody produced in rabbit (C15-1450-858)
Price: $879.43List Price: $977.14The gene RABEP1 (Rab GTPase-binding effector protein 1) is mapped to human chromosome 17p13.2. -
Add to Cart The item has been addedHPA023920-100ULRABEPK (Rab9 effector protein with kelch motifs) is a PIKfyve (FYVE finger-containing phosphoinositide kinase) chaperonin domain-binding protein. This gene is localized to human chromosome 9q33. -
Add to Cart The item has been addedHPA027715-100ULSigma-Aldrich
Anti-RABIF antibody produced in rabbit (C15-1451-587)
Price: $879.43List Price: $977.14Immunogen RAB interacting factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA054936-100ULSigma-Aldrich
Anti-RABIF antibody produced in rabbit (C15-1461-834)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RAB interacting factor Sequence GDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been added612-401-E22Thomas Scientific
Anti-Rabphilin 3A pS234 (Rabbit) Antibody, 100 L, Liquid
Price: $734.52List Price: $816.13Anti-Rabphilin 3A pS234 (Rabbit) antibody is suitable for use in Western Blotting and IHC. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedHPA006692-100ULImmunogen RAD1 checkpoint DNA exonuclease Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA006725-100ULSigma-Aldrich
Anti-RAD9A antibody produced in rabbit (C15-1446-707)
Price: $879.43List Price: $977.14Immunogen Cell cycle checkpoint control protein RAD9A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA048155-100ULSigma-Aldrich
Anti-RAD9A antibody produced in rabbit (C15-1459-470)
Price: $928.29List Price: $1,031.43Immunogen RAD9 checkpoint clamp component A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA040643-100ULImmunogen RAD9 homolog B ( S. pombe ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA051776-100ULImmunogen Ras association and DIL domains recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA054022-100ULImmunogen retinoic acid early transcript 1E recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
