Measuring and Observing and Testing Equipment

Anti-Raf 1 pS642 antibody is suitable for use in Western Blotting. Specific conditions for reactivity should be optimized by the end user.

V(D)J recombination-activating protein 1 (RAG-1) is also called RING finger protein 74. RAG-1 is a component of the RAG complex, which mediates the DNA cleavage phase during V(D)J recombination.

Immunogen Recombinant protein corresponding to recombination activating 2 Sequence HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen retinoic acid induced 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen retinoic acid induced 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen RAS like proto-oncogene A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen v-ral simian leukemia viral oncogene homolog A (ras related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Ral GTPase activating protein, alpha subunit 2 (catalytic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Ral GTPase activating protein, alpha subunit 2 (catalytic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Synthetic peptide directed towards the C terminal region of human RALY Biochem/physiol Actions In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is

Immunogen RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the