-
HPA031646-100UL
Sigma-Aldrich
Anti-RINT1 antibody produced in rabbit (C15-1453-207)
Price: $889.20List Price: $988.00Immunogen RAD50 interactor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA017866-100UL
Sigma-Aldrich
Anti-RIOK1 antibody produced in rabbit (C15-1448-822)
Price: $879.43List Price: $977.14Immunogen RIO kinase 1 (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA051446-100UL
Sigma-Aldrich
Anti-RIOK1 antibody produced in rabbit (C15-1460-665)
Price: $928.29List Price: $1,031.43Immunogen RIO kinase 1 (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA053249-100ULImmunogen Ras-like without CAAX 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA072174-100ULImmunogen Recombinant protein corresponding to Ras like without CAAX 2 Sequence MEVENEASCSPGSASGGSREYKVVM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA042051-100UL
Sigma-Aldrich
Anti-RLBP1 antibody produced in rabbit (C15-1457-038)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to retinaldehyde binding protein 1 Sequence TTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRL Application All Prestige Antibodies Powered by Atlas -
HPA044083-100UL
Sigma-Aldrich
Anti-RLBP1 antibody produced in rabbit (C15-1458-012)
Price: $928.29List Price: $1,031.43Immunogen retinaldehyde binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA034817-100UL
Sigma-Aldrich
ANTI-RNASEH1 ANTIBODY PRODUCED IN RABBIT (C15-1453-575)
Price: $977.14List Price: $1,085.71Immunogen ribonuclease H1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA043037-100UL
Sigma-Aldrich
Anti-RNASEH1 antibody produced in rabbit (C15-1457-488)
Price: $928.29List Price: $1,031.43Immunogen ribonuclease H1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
AV40646-100UL
Sigma-Aldrich
Anti-RNASEH2A antibody produced in rabbit (C15-1341-261)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human RNASEH2A Biochem/physiol Actions Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more -
AV40647-100UL
Sigma-Aldrich
Anti-RNASEH2A antibody produced in rabbit (C15-1341-262)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human RNASEH2A Biochem/physiol Actions Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology -
HPA041469-100ULImmunogen ribonuclease H2, subunit B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the