Measuring and Observing and Testing Equipment

Immunogen Recombinant protein corresponding to SEC14 and spectrin domain containing 1 Sequence PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen Recombinant protein corresponding to SEC14 and spectrin domain containing 1 Sequence WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen SET binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen SET binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen SET domain containing 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen SET domain and mariner transposase fusion gene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen senataxin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen senataxin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Synthetic peptide directed towards the middle region of human SFRP1 Application Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 &#956g/ml.

ASF/SF2 (alternative splicing factor/splicing factor 2)/splicing factor, arginine/serine-rich 1 (SFRS1) is a sequence specific (5′-splice cleavage) splicing factor involved in pre-mRNA splicing/alternative splicing. ASF/SF2 also mediates mRNA

Immunogen Synthetic peptide directed towards the N terminal region of human SFRS8 Biochem/physiol Actions SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein.

Immunogen sarcoglycan, epsilon Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the