-
Add to Cart The item has been addedHPA075017-100ULSigma-Aldrich
Anti-SLC16A8 antibody produced in rabbit (C15-1466-663)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to solute carrier family 16 (monocarboxylate transporter), member 8 Sequence KAAPSGPGTEGGASDTEDAEAEGDSEPLPVVAEEPGNLGALEVLSARGEPTEPEI Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA049286-100ULImmunogen solute carrier family 16, member 9 (monocarboxylic acid transporter 9) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA073224-100ULImmunogen Recombinant protein corresponding to solute carrier family 18 member A2 Sequence MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA062356-100ULImmunogen solute carrier family 1 member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA009172-100ULSigma-Aldrich
Anti-SLC1A2 antibody produced in rabbit (C15-1447-305)
Price: $879.43List Price: $977.14Excitatory amino acid transporter 2 (EAAT2) is a membrane glutamate transporter. This gene localizes to human chromosome 11p13-12. -
Add to Cart The item has been addedHPA067499-100ULSigma-Aldrich
ANTI-SLC1A2 ANTIBODY PRODUCED IN RABBIT (C15-1465-320)
Price: $977.14List Price: $1,085.71Immunogen solute carrier family 1 member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAV43827-100ULSigma-Aldrich
Anti-SLC1A4 antibody produced in rabbit (C15-1341-460)
Price: $898.29List Price: $998.10Solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 (ASCT1, SATT, SLC1A4) is a sodium dependent concentrative transporter of neutral amino acids such as alanine, glutamate, serine, cysteine and the imino acids, -
Add to Cart The item has been addedHPA034963-100ULSigma-Aldrich
Anti-SLC1A4 antibody produced in rabbit (C15-1453-617)
Price: $889.20List Price: $988.00Immunogen Recombinant protein corresponding to solute carrier family 1 (glutamate/neutral amino acid transporter), member 4. Sequence KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA034964-100ULSigma-Aldrich
Anti-SLC1A4 antibody produced in rabbit (C15-1453-618)
Price: $889.20List Price: $988.00Immunogen solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA006539-100ULImmunogen Solute carrier family 2, facilitated glucose transporter member 3 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are -
Add to Cart The item has been addedHPA063050-100ULImmunogen SLC2A4 regulator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA011935-100ULImmunogen Solute carrier family 2, facilitated glucose transporter member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
