Measuring and Observing and Testing Equipment

Immunogen solute carrier family 2 (facilitated glucose transporter), member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen solute carrier family 2 member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Solute carrier family 30, member 1 (SLC30A1, ZNT1, ZRC1) is a zinc transporter involved in regulating zinc and other divalent cation flux. SLC30A1/ ZNT1 is frequently coexpressed with L-type voltage-dependent calcium channel (LTCC), a major route

SLC30A1 (solute carrier family 30, member 1) is a transmembrane transporter of the zinc-regulating family of proteins. It has a wide range of tissue expression, with predominant expression in brain, heart, pancreas and testis.

Immunogen solute carrier family 30 (zinc transporter), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to solute carrier family 30 member 10 Sequence SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Solute carrier family 30 (zinc transporter), member 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen solute carrier family 32 member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 33 (acetyl-CoA transporter), member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to solute carrier family 33 member 1 Sequence PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter 1 (SLC38A1, ATA1, NAT2, SAT1, SNAT1), which is expressed during embryogenesis, is a sodium-dependent transporter of neutral zwitterionic amino acids, such a glutamine.

Immunogen solute carrier family 38, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are