Measuring and Observing and Testing Equipment

Immunogen solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Solute carrier family 9 member 7 (SLC9A7), also called sodium/hydrogen exchanger 7 (NHE7), is a 80 kDa protein present in trans-Golgi complex. It is a sodium/hydrogen exchanger with N-terminal membrane spanning region and C-terminal hydrophilic

Immunogen solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Solute carrier family 9 (sodium/hydrogen exchanger), member 9 (SLC9A9, NHE9, Nbla00118) is a member of the sodium/hydrogen exchanger family is a membrane protein that regulates the luminal pH of the recycling endosome, an essential organelle for

Immunogen solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Solute carrier organic anion transporter family member 2B1 (SLCO2B1) is widely expressed. It is present in liver, placenta, small intestine, kidney, brain, skin, heart, platelets, and skeletal muscle.

Immunogen Recombinant protein corresponding to solute carrier organic anion transporter family member 3A1 Sequence LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

SLFN proteins are found exclusively in mammals. SLFN11 (schlafen family member 11) protein contains a putative AAA (ATPases associated with diverse cellular activities) domain.