Measuring and Observing and Testing Equipment

Immunogen SMYD family member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen SMYD family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

SNAI1, also known as Snail homolog 1, is a transcription factor that down regulates the expression of ectodermal genes within the mesoderm and is thought to be essential for mesoderm formation in the developing embryo. SNAI1 is expressed in the

Immunogen Recombinant protein corresponding to snail family transcriptional repressor 1 Sequence SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen snail family zinc finger 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen synuclein, alpha interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen synuclein, beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

The gene SNCG (synuclein &#947) is a breast cancer specific gene that encodes a member of the synuclein family of proteins. SNCG mRNA is not found in normal or benign breast tissue.

Immunogen Staphylococcal nuclease domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Sequence ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL Application All

Staphylococcal nuclease and tudor domain containing 1 (SND1) is the conserved single-stranded cytosine-rich DNA binding protein that binds to the d(CTGCC)n sequence. It is composed of five repeated staphylococcal nuclease homology domains and a

Immunogen sushi, nidogen and EGF-like domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen sushi, nidogen and EGF-like domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,