-
AV40531-100UL
Sigma-Aldrich
Anti-SNRPA antibody produced in rabbit (C15-1341-246)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human SNRPA Biochem/physiol Actions SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. -
HPA046440-100UL
Sigma-Aldrich
Anti-SNRPA antibody produced in rabbit (C15-1458-856)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA054834-100UL
Sigma-Aldrich
Anti-SNRPA antibody produced in rabbit (C15-1461-811)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA003482-100UL
Sigma-Aldrich
Anti-SNRPB antibody produced in rabbit (C15-1445-977)
Price: $879.43List Price: $977.14Immunogen small nuclear ribonucleoprotein polypeptides B and B1 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. -
HPA067842-100UL
Sigma-Aldrich
Anti-SNRPB antibody produced in rabbit (C15-1465-379)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptides B and B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA050814-100UL
Sigma-Aldrich
Anti-SNRPB2 antibody produced in rabbit (C15-1460-421)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA076104-100UL
Sigma-Aldrich
Anti-SNRPB2 antibody produced in rabbit (C15-1466-830)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to small nuclear ribonucleoprotein polypeptide B2 Sequence AKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA042419-100UL
Sigma-Aldrich
Anti-SNRPC antibody produced in rabbit (C15-1457-201)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA055490-100UL
Sigma-Aldrich
Anti-SNRPC antibody produced in rabbit (C15-1462-035)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA067154-100ULImmunogen syntrophin alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
-
HPA024659-100ULThe gene SNTB1 (syntrophin β 1) is mapped to human chromosome 8. The encoded protein belongs to the syntrophin family and contains a PDZ (PSD95, Dlg1 and zo-1) domain.
-
HPA072282-100ULImmunogen syntrophin, gamma 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the