Measuring and Observing and Testing Equipment

C1orf124/Spartan, a protein that contains a PCNA-interacting peptide motif, called a PIP box, and a UBZ4 ubiquitin-binding domain, is involved in Rad18-mediated Proliferating Cell Nuclear Antigen (PCNA) ubiquitination and the regulation of DNA

Immunogen Synthetic peptide directed towards the N terminal region of human SPRY3 Application Anti-SPRY3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen sprouty RTK signaling antagonist 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to sprouty RTK signaling antagonist 4 Sequence SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen SPRY domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen SPRY domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen SPRY domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen SPRY domain containing 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen splA/ryanodine receptor domain and SOCS box containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to splA/ryanodine receptor domain and SOCS box containing 4 Sequence QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen spectrin, alpha, erythrocytic 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen spectrin, alpha, erythrocytic 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in