-
HPA041589-100UL
Sigma-Aldrich
Anti-SQRDL antibody produced in rabbit (C15-1456-779)
Price: $928.29List Price: $1,031.43Immunogen sulfide quinone reductase-like (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA064165-100UL
Sigma-Aldrich
Anti-SQSTM1 antibody produced in rabbit (C15-1464-572)
Price: $928.29List Price: $1,031.43Immunogen sequestosome 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA068843-100UL
Sigma-Aldrich
Anti-SQSTM1 antibody produced in rabbit (C15-1465-557)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to sequestosome 1 Sequence HGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA044598-100UL
Sigma-Aldrich
Anti-SRA1 antibody produced in rabbit (C15-1458-213)
Price: $928.29List Price: $1,031.43Immunogen steroid receptor RNA activator 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050153-100UL
Sigma-Aldrich
Anti-SRA1 antibody produced in rabbit (C15-1460-203)
Price: $928.29List Price: $1,031.43Immunogen steroid receptor RNA activator 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA045677-100UL
Sigma-Aldrich
Anti-SREK1IP1 antibody produced in rabbit (C15-1458-605)
Price: $928.29List Price: $1,031.43Immunogen SREK1-interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA062853-100UL
Sigma-Aldrich
Anti-SREK1IP1 antibody produced in rabbit (C15-1464-207)
Price: $928.29List Price: $1,031.43Immunogen SREK1-interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA042737-100UL
Sigma-Aldrich
Anti-SRFBP1 antibody produced in rabbit (C15-1457-343)
Price: $928.29List Price: $1,031.43Immunogen serum response factor binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA058150-100UL
Sigma-Aldrich
Anti-SRFBP1 antibody produced in rabbit (C15-1462-846)
Price: $928.29List Price: $1,031.43Immunogen serum response factor binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA052416-100ULImmunogen SLIT-ROBO Rho GTPase activating protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA019004-100UL
Sigma-Aldrich
Anti-SRI antibody produced in rabbit (C15-1449-164)
Price: $879.43List Price: $977.14Immunogen sorcin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA073666-100UL
Sigma-Aldrich
Anti-SRI antibody produced in rabbit (C15-1466-420)
Price: $928.29List Price: $1,031.43Immunogen sorcin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human