-
HPA054675-100UL
Sigma-Aldrich
Anti-TDRD15 antibody produced in rabbit (C15-1461-762)
Price: $977.14List Price: $1,085.71Immunogen Uncharacterized protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA067153-100ULImmunogen Recombinant protein corresponding to tudor domain containing 3 Sequence PRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGP Application All Prestige Antibodies Powered by Atlas Antibodies are developed
-
HPA029418-100ULImmunogen tudor domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA024529-100ULImmunogen Tudor domain-containing protein 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA016419-100UL
Sigma-Aldrich
Anti-TDRKH antibody produced in rabbit (C15-1448-495)
Price: $879.43List Price: $977.14Immunogen Tudor and KH domain-containing protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA019625-100UL
Sigma-Aldrich
Anti-TDRKH antibody produced in rabbit (C15-1449-361)
Price: $879.43List Price: $977.14Immunogen Tudor and KH domain-containing protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA008462-100ULThe gene encoding testis development related protein (TDRP) is located on chromosome 8 and encodes 198 amino acids. It is expressed in the cytoplasm and nuclei of spermatogenic cells, mainly in spermatocytes.
-
AV39521-100ULTEAD1 is a transcriptional factor that blocks the expression of prolactin in human uterine decidual cells. TEAD1 mutation has been linked to Sveinsson′s chorioretinal atrophy.
-
HPA057339-100UL
Sigma-Aldrich
Anti-TEAD1 antibody produced in rabbit (C15-1462-632)
Price: $928.29List Price: $1,031.43Immunogen TEA domain family member 1 (SV40 transcriptional enhancer factor) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA062471-100UL
Sigma-Aldrich
Anti-TEAD1 antibody produced in rabbit (C15-1464-089)
Price: $928.29List Price: $1,031.43Immunogen TEA domain family member 1 (SV40 transcriptional enhancer factor) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
AV38278-100ULImmunogen Synthetic peptide directed towards the C terminal region of human TEAD3 Biochem/physiol Actions TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain.
-
HPA028906-100ULImmunogen TEA domain family member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are